PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0010s0171.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family HB-other
Protein Properties Length: 369aa    MW: 42146.1 Da    PI: 4.922
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0010s0171.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox24.64.4e-083103432154
                           HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
              Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                           k +yp+++e+e+L + +gL+ +qV +WF N+R +
  Sphfalx0010s0171.1.p 310 KWPYPTEDEKEKLIQDTGLELKQVNNWFINQRKR 343
                           469*****************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012557.9E-991134IPR005540KNOX1
PfamPF037901.3E-993129IPR005540KNOX1
SMARTSM012566.0E-15145200IPR005541KNOX2
PfamPF037918.8E-11151199IPR005541KNOX2
PROSITE profilePS512139.045264284IPR005539ELK domain
PROSITE profilePS5007111.564284347IPR001356Homeobox domain
SuperFamilySSF466891.88E-16286354IPR009057Homeodomain-like
SMARTSM003891.8E-9286351IPR001356Homeobox domain
CDDcd000867.26E-11287348No hitNo description
Gene3DG3DSA:1.10.10.606.5E-26291347IPR009057Homeodomain-like
PfamPF059203.9E-17304343IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MMNNMHQPAD PQHREDEHLV TSTDCLLRSA SHTPPGMVQT ETHHSAAHDQ QDAVSQQLFV  60
DLRHYPYNLN QDDVFGGQGT TGDQKEEWEI ARYKAMIVAH PLYLQLLELH AGCLRMGTPV  120
DQLRNIDMQM ERYMDVTNKY AVLQLDLGPE EQAELNEFMA QYVVVITAFK NHLQQHVYTD  180
ITEAMMSCWE LEQALSNFTG QVSPLESTGA TMSDSESECD VDGSDDGYEP VSMDQQLETS  240
AAGMYGPLVP SETDRSLMER VRRDLKQELQ EGYRAKIEDV REEIMRKRRA GKLPDGTTTV  300
LKAWWNAHSK WPYPTEDEKE KLIQDTGLEL KQVNNWFINQ RKRNWHSNPL AASSSSGVIM  360
QKSTKRKR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A3e-13287349870Homeobox protein PKNOX1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001772723.11e-120KNOX class 2 protein MKN1-3
SwissprotP480011e-105KNAT4_ARATH; Homeobox protein knotted-1-like 4
TrEMBLA9T2881e-120A9T288_PHYPA; KNOX class 2 protein MKN1-3
STRINGPP1S154_83V6.11e-117(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11060.11e-106KNOTTED1-like homeobox gene 4